DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and lman2

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001075216.2 Gene:lman2 / 557960 ZFINID:ZDB-GENE-070209-149 Length:354 Species:Danio rerio


Alignment Length:283 Identity:92/283 - (32%)
Similarity:142/283 - (50%) Gaps:50/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KYSFKPPYLAQKDGTVPF--WEYGGNAIASSESVRVAPSLRSQKGAIWTKSQTNFDWWDVEIVFR 100
            ::|...||  |..|:.|.  |::.|:.:.:|:.||:.|..||::|:||.........|::.:.|:
Zfish    54 EHSLIKPY--QGVGSSPSSQWDFWGSTLVTSQYVRLTPDERSKQGSIWNTVPCYLKDWEMHVQFK 116

  Fly   101 VTGRGR--IGADGLAFWYTTEKGDYNGPVFGSSDRWNGLAIMFDSFDNDNK---HNNPYISAVLN 160
            :.|.|:  :..||.|.|||.|: .:.|||||:.|.:.||||..|:|.||.:   .:.|||||::|
Zfish   117 IHGSGKKNLHGDGFAMWYTKER-LHPGPVFGNQDHFVGLAIFVDTFRNDLQGMDRSFPYISAMVN 180

  Fly   161 DGTKLYDHAEDGTTQLLSGCLRDFRNKPFPTRARIEYYNNVLTVMIHNGMSNNNDDYELCLRADG 225
            :|:..|:|.:||.:..|.||..:.|||...|...|.|....||:|:.   .::.:|::.|:...|
Zfish   181 NGSLPYEHGKDGRSTELGGCSVEVRNKEHDTYLAIRYSKGRLTIMVD---VDDQNDWKECVDIGG 242

  Fly   226 VNLPKNGYFGISAATGGLADDHDVFHFLTTSLHAAGQVQEQPKVENQEKLTQEYKEYQDKLEKQK 290
            |.||...|||.|||||.|:|:||:.                           ..|.||..:|...
Zfish   243 VRLPTGYYFGASAATGDLSDNHDII---------------------------SMKMYQLMVEHTL 280

  Fly   291 QEYKKDHPDEHKDEEDWEEFYES 313
            :|          |.:||.:...|
Zfish   281 EE----------DSQDWTKIEPS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 83/226 (37%)
lman2NP_001075216.2 lectin_VIP36_VIPL 50..299 CDD:173889 92/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377709at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.