DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and lman2l

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_012814397.1 Gene:lman2l / 496820 XenbaseID:XB-GENE-999355 Length:353 Species:Xenopus tropicalis


Alignment Length:290 Identity:87/290 - (30%)
Similarity:143/290 - (49%) Gaps:33/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRPTFLAILCFLAWNPSSEATGNLSPGAVGVHRRFEYKYSFKPPYLAQKDGTVPFWEYGGNAIAS 65
            :|...|.|:.|:.|:..:         |.......:.::|...||......|...|:..||::.:
 Frog    21 VRVLVLLIVAFVHWDVGT---------ADQTEEYLKREHSLSKPYQGVGSSTSSLWDLLGNSLVT 76

  Fly    66 SESVRVAPSLRSQKGAIWTKSQTNFDWWDVEIVFRVTGRGR--IGADGLAFWYTTEKGDYNGPVF 128
            .:.||:.|.|:|::||:|.:.......|::::.|::.|:|:  :..||.|.|||.::.. .||||
 Frog    77 PQYVRLTPDLQSKQGAVWNRVPCYLRDWEMQVHFKIHGQGKKNLNGDGFAIWYTKDRMQ-AGPVF 140

  Fly   129 GSSDRWNGLAIMFDSFDNDNKHNN--------------PYISAVLNDGTKLYDHAEDGTTQLLSG 179
            ||.|.:.||.:..|::.|:.|.:.              |||||::::|:..|||:.||.|..|.|
 Frog   141 GSKDNFVGLGLFVDTYPNEEKQHESQRKRYSPSMQRVFPYISAMVSNGSITYDHSRDGRTTELGG 205

  Fly   180 CLRDFRNKPFPTRARIEYYNNVLTVMIHNGMSNNNDDYELCLRADGVNLPKNGYFGISAATGGLA 244
            |....||....|...|.|....||:|:.   .:...:::.|:...||.||:..:||.||.||.|:
 Frog   206 CTAMVRNLNHDTFLVIRYVKRRLTIMVD---IDGKQEWKDCVDVPGVRLPRGYFFGASAVTGDLS 267

  Fly   245 DDHDVFHFLTTSLHAAGQVQEQPKVENQEK 274
            |:|||.......|    .|:..|:.|..:|
 Frog   268 DNHDVISLKLYQL----SVERTPEEEKMDK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 76/240 (32%)
lman2lXP_012814397.1 lectin_VIP36_VIPL 45..304 CDD:173889 81/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377709at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.