DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and Lman2

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001108496.1 Gene:Lman2 / 290994 RGDID:1308965 Length:358 Species:Rattus norvegicus


Alignment Length:272 Identity:91/272 - (33%)
Similarity:142/272 - (52%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TFLAILCFLAWNPSSEATGNLSPGAVGVHRRFEYKYSFKPPYLAQKDGTVPFWEYGGNAIASSES 68
            |||..|..|....:....||        ....:.::|...||......::|.|::.|:.:.:|:.
  Rat    33 TFLHFLLLLGLVAADITDGN--------SEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQY 89

  Fly    69 VRVAPSLRSQKGAIWTKSQTNFDWWDVEIVFRV--TGRGRIGADGLAFWYTTEKGDYNGPVFGSS 131
            ||:.|..||::|:||.........|::.:.|:|  ||:..:..||:|.|||.:: ...||||||.
  Rat    90 VRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDR-LVPGPVFGSK 153

  Fly   132 DRWNGLAIMFDSFDNDNKHNN--PYISAVLNDGTKLYDHAEDGTTQLLSGCLRDFRNKPFPTRAR 194
            |.::|||:..|::.||.....  ||||.::|:|:..|||::||....|:||..||||:...|...
  Rat   154 DNFHGLAVFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWSELAGCTADFRNRDHDTFLA 218

  Fly   195 IEYYNNVLTVMIHNGMSNNNDDYELCLRADGVNLPKNGYFGISAATGGLADDHDVFHFLTTSLHA 259
            :.|....||||  ..:.:.| :::.|:...||.||...|||.||.||.|:|:||:.......|  
  Rat   219 VRYSRGRLTVM--TDLEDKN-EWKNCIDVTGVRLPTGYYFGASAGTGDLSDNHDLISIKLFQL-- 278

  Fly   260 AGQVQEQPKVEN 271
              .|:..|:.|:
  Rat   279 --TVERTPEEES 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 80/228 (35%)
Lman2NP_001108496.1 lectin_VIP36_VIPL 55..303 CDD:173889 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377709at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.