DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and SPBC4F6.05c

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_596105.1 Gene:SPBC4F6.05c / 2540877 PomBaseID:SPBC4F6.05c Length:384 Species:Schizosaccharomyces pombe


Alignment Length:344 Identity:74/344 - (21%)
Similarity:130/344 - (37%) Gaps:70/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WEYGGNAIASSESVRVA--PSLRSQKGAIWTKSQTNFDWWDVEIVFRVTGRGRIGADGLAFWYTT 118
            |::.|:....|..|.:.  .|..::.|::|:.|......|.:...| |...........|.|||:
pombe    39 WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQVGWQLSTSF-VAHVSENENTFFAIWYTS 102

  Fly   119 EKGDYNGPVFGSSDRWNGLAIMFDSFDNDNKHNNPYISAVLNDGTKLYDHAEDGTTQLLSGCLRD 183
            ..|. .|||||:||:|:||.|. ...|...|   .::...|||  |.::             |..
pombe   103 AVGS-EGPVFGASDKWDGLLIS-QEIDQTGK---IFVRGYLND--KSFE-------------LAQ 147

  Fly   184 FRNKPFPTRARI------EYYNNVLTVMIHNGMSN----NNDDYELCLRADGVNLPKNGYFGISA 238
            |.:...|..|:.      |..||:  ::.:...|.    .||  :.|.:...|.||:..|||:|:
pombe   148 FTDPDLPPFAKCTIESSPEALNNI--ILKYGDQSGLELFVND--KPCFQVKDVILPQGYYFGVSS 208

  Fly   239 ATGGLAD---------------DHDVFHFLTTSLHAAGQVQEQPKVENQEKLT---QEYKEYQDK 285
            .:....|               :::..:..:.:..:.|.......|.:.|.|.   .:..:..:.
pombe   209 QSTSAKDLVALSNLNILPPDTSNNENLNPTSNTKQSVGDNTSPQTVIDTEGLNAIKADLAKLFNL 273

  Fly   286 LEKQKQEYKKDH------PDEHKDEEDWEEFYESEN----QRELRQIWQGQSQIAD----HLREL 336
            :|.|:|:....|      .:...|.....:| .||.    ::.|......||..||    ||.|.
pombe   274 VESQRQKMDSLHFALTNALERLNDISSTSQF-PSERFNALEKLLHDSLSAQSSTADGTSKHLAEF 337

  Fly   337 SRKVDEIIGRQETTLSLVS 355
            .:::.:.:|...:..:|.:
pombe   338 EKEIKKAMGNAYSPYNLTN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 52/228 (23%)
SPBC4F6.05cNP_596105.1 Lectin_leg-like 23..229 CDD:281392 52/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12223
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4179
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.