DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and SPCC126.08c

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_588451.1 Gene:SPCC126.08c / 2538834 PomBaseID:SPCC126.08c Length:312 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:67/276 - (24%)
Similarity:126/276 - (45%) Gaps:28/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GAVGVHRRFEYKYSFKPPYLAQKDGTVPFWEYGGNAIASSES-VRVAPSLRSQKGAIWTKSQTNF 90
            ||:......| :.|.:.||:......: :|||||:.:...:: :.:...:::|:|.|.|:..|..
pombe    19 GALAETSHLE-RLSLEAPYINHGMRNL-WWEYGGSTVIDRKNGIFLTQDVQNQQGWISTRLPTPS 81

  Fly    91 DWWDVEIVFRVTGRG-RIGADGLAFWYTTEKGDYNGPVFGSSDRWNGLAIMFDSFDNDNKHNN-- 152
            ..::|...||:.... .:..|||||:...|:.. .|||||.:|::||..|..|:::|   |..  
pombe    82 SSFEVLFQFRINSESTSLFGDGLAFFLAAERAK-PGPVFGFTDKFNGYGIFIDTYNN---HRPGT 142

  Fly   153 --PYISAVLNDGTKLYDHAEDGTTQLLSGC-LRDFRNKPFPTRARIEYYNNVLTV---MIHNGMS 211
              |.:..:..||...||:..||....::.| ..:.|...: ...:::|..|...:   :.:.|.|
pombe   143 LFPRVIVMKGDGHTPYDYENDGKANEIASCSALNVRGNDY-NLGKLKYDKNAKKLRFEIAYQGSS 206

  Fly   212 NNNDDYELCLRADGVNLPKNGYFGISAATGGLADDHDVFHFLT---TSLHAAGQVQEQPKVENQE 273
            :    :..|...:.|.||...:...||.||.|::.|::...|:   |.:...|    .|::..:|
pombe   207 S----FIKCFDLNEVELPLTTFMSFSAHTGDLSESHEIASILSRTITDIDDEG----TPEIPAEE 263

  Fly   274 KLTQEYKEYQDKLEKQ 289
            .....|.:.:...:|:
pombe   264 LKGTTYGQKKGSFKKR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 60/237 (25%)
SPCC126.08cNP_588451.1 Lectin_leg-like 24..250 CDD:281392 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1509
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12223
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.