DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ergic53 and ile-2

DIOPT Version :9

Sequence 1:NP_524776.1 Gene:ergic53 / 44679 FlyBaseID:FBgn0035909 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_508151.1 Gene:ile-2 / 180423 WormBaseID:WBGene00002071 Length:347 Species:Caenorhabditis elegans


Alignment Length:231 Identity:86/231 - (37%)
Similarity:128/231 - (55%) Gaps:22/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GVHRRFEYKYSFKPPYLAQKDGTVPFWEYGGNAIASSESVRVAPSLRSQKGAIWTKSQTNFDW-- 92
            |.::|   ::|...||.. ....:|.|...|:...||..:|:....:|:.||:|   .|...|  
 Worm    43 GYYKR---EHSLIKPYTG-SGADIPNWNIIGSTFVSSNQIRLTADEQSKAGALW---NTQPVWSR 100

  Fly    93 -WDVEIVFRVTG-RGRIGADGLAFWYTTEKGDYNGPVFGSSDRWNGLAIMFDSFDNDN---KHNN 152
             |::::.|:||| .|.:..||:|.|||:|. :..|||||..|.:.|||:..|::.|.|   :|.:
 Worm   101 DWELQVSFKVTGSTGDLFGDGMAIWYTSEP-NILGPVFGGKDYFRGLAVFLDTYSNHNGPHQHGH 164

  Fly   153 PYISAVLNDGTKLYDHAEDGT-TQL---LSGCLRDFRNKPFPTRARIEYYNNVLTVMIHNGMSNN 213
            |:|||:::||:..|||.:||| |||   .:||...||||...|:..|.|..:.|::.   ....|
 Worm   165 PFISAMVSDGSLHYDHDKDGTHTQLGGENTGCTAKFRNKDHDTQVLIRYVGDTLSIF---SDIEN 226

  Fly   214 NDDYELCLRADGVNLPKNGYFGISAATGGLADDHDV 249
            ...:.||:..:.|.||...|.|:|||||.|:|.|||
 Worm   227 KGIWNLCMSVNNVQLPTGYYIGVSAATGDLSDAHDV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ergic53NP_524776.1 lectin_ERGIC-53_ERGL 33..258 CDD:173890 85/228 (37%)
ile-2NP_508151.1 lectin_L-type 44..295 CDD:387354 85/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377709at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.