DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and DCLK3

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001381601.1 Gene:DCLK3 / 85443 HGNCID:19005 Length:817 Species:Homo sapiens


Alignment Length:390 Identity:117/390 - (30%)
Similarity:180/390 - (46%) Gaps:56/390 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GQNELTRYSSEDVSGNESSEAPNMTEVERQ-------AELNRHKEEMQKKRRKKRISS------S 107
            |..:|.|...|:... |..:.|.|:...|.       |:|.:..:...::.:.:|.|.      .
Human   452 GFEKLRRTRGEEKEA-EKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMG 515

  Fly   108 LHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHARARVFREVETFHHCQG 172
            :.::..::.|: ||.::|:|.:|.|:.|.:..|...||:|:|||.....:..:............
Human   516 IIAANVEKHYE-TGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILIIQSLS 579

  Fly   173 HLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAH 237
            |..|::|.|.:|.|.:.||:.|.:.||.|...|.|.:.|.|.:|:.:|.::...|..:|.|.|.|
Human   580 HPNIVKLHEVYETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVH 644

  Fly   238 RDLKPENILCVKT-DSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFV 301
            |||||||:|..:. |....:|:.||.|...:           ...:.|..|:..::|||::    
Human   645 RDLKPENLLVQRNEDKSTTLKLADFGLAKHV-----------VRPIFTVCGTPTYVAPEIL---- 694

  Fly   302 GEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPE 366
             ....|....|:|:.|||.||||||:|||             .:....|:.||..||.|||.|..
Human   695 -SEKGYGLEVDMWAAGVILYILLCGFPPF-------------RSPERDQDELFNIIQLGHFEFLP 745

  Fly   367 AEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWI----------RMCEQEPPASKHGR-RHK 420
            ..|.::||.||||:|.|||.....|.:|..||.||||          |..:..|.:..|.| :||
Human   746 PYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWIETAGKTNTVKRQKQVSPSSEGHFRSQHK 810

  Fly   421  420
            Human   811  810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 97/288 (34%)
S_TKc 117..403 CDD:214567 97/286 (34%)
DCLK3NP_001381601.1 DCX_DCLK3 93..177 CDD:340528
STKc_DCKL3 524..781 CDD:271087 96/286 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.