DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and CDPK1

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_564066.2 Gene:CDPK1 / 838470 AraportID:AT1G18890 Length:545 Species:Arabidopsis thaliana


Alignment Length:418 Identity:116/418 - (27%)
Similarity:170/418 - (40%) Gaps:74/418 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NELTRYSSEDVSGNESSEAPNMTEVERQAELNRHKEEMQKK----RRKKRISSSLHSSTFQELYK 118
            |...|..|::...:...:.||     |..:||....:..:.    |..|.:....:.:...:.| 
plant     5 NACVRPDSKESKPSSKPKKPN-----RDRKLNPFAGDFTRSPAPIRVLKDVIPMSNQTQISDKY- 63

  Fly   119 LTGEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHARAR-------VFREVETFHHCQGHLGI 176
            :.|..||.|.:.....|.:..|....|.|.|.|    .:.|       |.|||........|..:
plant    64 ILGRELGRGEFGITYLCTDRETHEALACKSISK----RKLRTAVDIEDVRREVAIMSTLPEHPNV 124

  Fly   177 LQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLK 241
            ::|...:||:|..:||.|...||.|..||.....::|..|:.:.:.||..:...|..|:.|||||
plant   125 VKLKASYEDNENVHLVMELCEGGELFDRIVARGHYTERAAAAVARTIAEVVMMCHSNGVMHRDLK 189

  Fly   242 PENILCVKTDSLCPIKICDFDLG----SGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVG 302
            |||.|........|:|..||.|.    .|.|||..:.||             .:|||||:     
plant   190 PENFLFANKKENSPLKAIDFGLSVFFKPGDKFTEIVGSP-------------YYMAPEVL----- 236

  Fly   303 EAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEA 367
             ...|....|:||.|||.||||||.|||         |...|      :.:..:|..|...|...
plant   237 -KRDYGPGVDVWSAGVIIYILLCGVPPF---------WAETE------QGVALAILRGVLDFKRD 285

  Fly   368 EWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEPPASKHGRRHKALQTP-SNIRRN 431
            .|..:|:.||.|:..:|....:.||:|:.||.||||:..::.|            ..| .:|.|:
plant   286 PWPQISESAKSLVKQMLDPDPTKRLTAQQVLAHPWIQNAKKAP------------NVPLGDIVRS 338

  Fly   432 HQSAREISQFAESAMAVKRVVLQHFSMR 459
            .  .::.|........|.||:.:|.|::
plant   339 R--LKQFSMMNRFKKKVLRVIAEHLSIQ 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 94/298 (32%)
S_TKc 117..403 CDD:214567 94/296 (32%)
CDPK1NP_564066.2 STKc_CAMK 62..320 CDD:270687 93/296 (31%)
FRQ1 360..506 CDD:227455 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.