DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and PEPKR1

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_172719.1 Gene:PEPKR1 / 837815 AraportID:AT1G12580 Length:522 Species:Arabidopsis thaliana


Alignment Length:308 Identity:96/308 - (31%)
Similarity:146/308 - (47%) Gaps:34/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ISSSLHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDK---IPGHARARVFREVE 165
            |.:.::.|..::.|.| ||.||.|.:..::.|.:..|....|.|.|.|   :.......:..|:.
plant    31 ILNPVNVSNLKDRYVL-GEQLGWGQFGVIRVCSDKLTGERLACKSISKDRLVTQDDMKSIKLEIA 94

  Fly   166 TFHHCQGHLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFL 230
            ......||..::.|...:|:.:..:||.|...||.|..:::::..:||..|..:.|.:...:.|.
plant    95 IMAKLAGHPNVVNLKAVYEEKDSVHLVMELCAGGELFHKLEKYGRYSEVRARVLFKHLMQVVKFC 159

  Fly   231 HKKGIAHRDLKPENILCVKTDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPE 295
            |..||.||||||||||.....|..|||:.||.|.:.||....:|.         .|||..::|||
plant   160 HDSGIVHRDLKPENILMATMSSSSPIKLADFGLATYIKPGEKLSG---------TVGSPFYIAPE 215

  Fly   296 VVDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEG 360
            |:      |..|::..|:||.|||.||||.|.|||         |.:      .:..:|::::..
plant   216 VL------AGGYNQAADVWSAGVILYILLSGAPPF---------WGK------TKSKIFDAVRAA 259

  Fly   361 HFSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQ 408
            ...|....|.:::..|||||..:|....|.||||:.||.|.|:....:
plant   260 DLRFSAEPWDNITSYAKDLIRGMLCVDPSQRLSADEVLAHSWMEQLSE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 93/290 (32%)
S_TKc 117..403 CDD:214567 93/288 (32%)
PEPKR1NP_172719.1 STKc_CAMK 43..301 CDD:270687 93/288 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.