DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and AT5G24430

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_197831.3 Gene:AT5G24430 / 832514 AraportID:AT5G24430 Length:594 Species:Arabidopsis thaliana


Alignment Length:307 Identity:96/307 - (31%)
Similarity:145/307 - (47%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FQELYKLTGEILGEGAYASVQTC-----VNIYTDLEYAVKVIDKIPGHARAR---VFREVETFHH 169
            |:..|:| |:.:|.|.:.  .||     .....:...|||:|.|....:...   |.|||:....
plant   139 FEGKYEL-GKEVGRGHFG--HTCWAKAKKGKMKNQTVAVKIISKAKMTSTLSIEDVRREVKLLKA 200

  Fly   170 CQGHLGILQLIEFFEDDEKFYLVFEKINGGPLLSRI-QEHICFSEHEASQIIKEIASGLDFLHKK 233
            ..||..:::..:.:||.:..::|.|...||.||.|| .....:.|.:|.:|:.:|.|...|.|.:
plant   201 LSGHRHMVKFYDVYEDADNVFVVMELCEGGELLDRILARGGRYPEVDAKRILVQILSATAFFHLQ 265

  Fly   234 GIAHRDLKPENILCVKTDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVD 298
            |:.||||||||.|....:....:|:.||.|...|::         ..:|...||||.::||||:.
plant   266 GVVHRDLKPENFLFTSRNEDAILKVIDFGLSDFIRY---------DQRLNDVVGSAYYVAPEVLH 321

  Fly   299 LFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFS 363
                  ..|....|:||:|||:||||||..||.|              || :..:|..:...:.:
plant   322 ------RSYSTEADMWSIGVISYILLCGSRPFYG--------------RT-ESAIFRCVLRANPN 365

  Fly   364 FPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEP 410
            |.:..|..:|..|||.:..||.|....|::|...|.|||:|  ::.|
plant   366 FEDMPWPSISPTAKDFVKRLLNKDHRKRMTAAQALAHPWLR--DENP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 92/296 (31%)
S_TKc 117..403 CDD:214567 92/294 (31%)
AT5G24430NP_197831.3 STKc_CAMK 142..404 CDD:270687 91/294 (31%)
S_TKc 143..405 CDD:214567 92/294 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24349
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.