DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and CAMK2B

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:XP_011513849.1 Gene:CAMK2B / 816 HGNCID:1461 Length:709 Species:Homo sapiens


Alignment Length:485 Identity:126/485 - (25%)
Similarity:212/485 - (43%) Gaps:98/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ISSSLHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVID--KIPGHARARVFREVET 166
            :::::..:.|.:.|:|. |.:|:||::.|:.||.:.|..|||.|:|:  |:......::.||...
Human     1 MATTVTCTRFTDEYQLY-EDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARI 64

  Fly   167 FHHCQ--GHLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDF 229
               |:  .|..|::|.:...::...||||:.:.||.|...|.....:||.:||..|::|...:..
Human    65 ---CRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLH 126

  Fly   230 LHKKGIAHRDLKPENILCVKTDSLCPIKICDFDLGSGIKFTTDISS---PAATPQLLTPVGSAEF 291
            .|:.|:.||||||||:|.........:|:.||  |..|:...|..:   .|.||         .:
Human   127 CHQMGVVHRDLKPENLLLASKCKGAAVKLADF--GLAIEVQGDQQAWFGFAGTP---------GY 180

  Fly   292 MAPEVVDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFES 356
            ::|||:     ....|.|..|:|:.|||.||||.|||||         |:..      |..|::.
Human   181 LSPEVL-----RKEAYGKPVDIWACGVILYILLVGYPPF---------WDED------QHKLYQQ 225

  Fly   357 IQEGHFSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEPPAS-KHGRRHK 420
            |:.|.:.||..||..|:.|||:||:.:|....:.|::|...|.|||:  |::...|| .|.:...
Human   226 IKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWV--CQRSTVASMMHRQETV 288

  Fly   421 ALQTPSNIRRNHQSAREISQFAESAMAVKRVVLQHFSMRYDYMKERPNIYQPSQAYMDAYSDENY 485
            ......|.||.          .:.|:....:..::||:                           
Human   289 ECLKKFNARRK----------LKGAILTTMLATRNFSV--------------------------- 316

  Fly   486 NPKPPGHYTRNRSQRNPASS--LCGYGGRMSSMHGQRANSRRSSRNASRNASAIYPNSGGF---- 544
                 |..|...:..:.|:|  ..|...:..|:..::|:..:...|:::|::|.....|..    
Human   317 -----GRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAA 376

  Fly   545 ---KTLNVHEEDD--DDEGLEAFGHIDDDD 569
               :|..:|...|  .:....|...|:|:|
Human   377 LEPQTTVIHNPVDGIKESSDSANTTIEDED 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 96/294 (33%)
S_TKc 117..403 CDD:214567 96/292 (33%)
CAMK2BXP_011513849.1 STKc_CaMKII 12..303 CDD:270988 104/337 (31%)
S_TKc 14..272 CDD:214567 96/292 (33%)
CaMKII_AD 577..704 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.