DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and camk1b

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:XP_021335371.1 Gene:camk1b / 794026 ZFINID:ZDB-GENE-141014-1 Length:394 Species:Danio rerio


Alignment Length:300 Identity:106/300 - (35%)
Similarity:146/300 - (48%) Gaps:42/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDK--IPGHARARVFREVETFHHCQG 172
            ::..:::|... |:||.||::.|.......|....|||.|.|  :.|...: :..|:...|..: 
Zfish    26 TANIKDIYDFK-EVLGTGAFSEVMLAEEKRTRKLVAVKCIAKKALEGKENS-IENEIAVLHKIK- 87

  Fly   173 HLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAH 237
            |..|:.|.:.||.....|||.:.::||.|..||.|...::|.:||::|::|...:.:||..||.|
Zfish    88 HANIVSLEDIFESKSHLYLVMQLVSGGELFDRIVEKGFYTEKDASKLIQQILDAVKYLHDMGIVH 152

  Fly   238 RDLKPENILCVKTDSLCPIKICDFDL----GSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVD 298
            |||||||:|....|....|.|.||.|    |||...:|...:|.             ::||||: 
Zfish   153 RDLKPENLLYYSMDEESKIMISDFGLSKIEGSGSVMSTACGTPG-------------YVAPEVL- 203

  Fly   299 LFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFS 363
                ....|.|..|.||:||||||||||||||           ..||    ...|||.|....:.
Zfish   204 ----AQKPYSKAVDCWSIGVIAYILLCGYPPF-----------YDEN----DAKLFEQILRAEYE 249

  Fly   364 FPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWI 403
            |....|.|:||.|||.|.:|:.|..:.|.:.|..|.||||
Zfish   250 FDSPYWDDISDSAKDFIVHLMEKDPNQRYTCEQALQHPWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 104/293 (35%)
S_TKc 117..403 CDD:214567 104/291 (36%)
camk1bXP_021335371.1 PKc_like 29..291 CDD:328722 105/296 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.