DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and camk4

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001017607.1 Gene:camk4 / 550270 ZFINID:ZDB-GENE-050417-76 Length:364 Species:Danio rerio


Alignment Length:292 Identity:94/292 - (32%)
Similarity:138/292 - (47%) Gaps:32/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHARARVFREVETFHHCQGHLGI 176
            |..:.|:|..| ||.||.:.|..|....|...||||::.|.......|.  |:...... .|..|
Zfish    24 TLADFYELESE-LGRGATSVVYRCRQKGTQKHYAVKMLKKTVDKKIVRT--EIGVLLRL-SHPNI 84

  Fly   177 LQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLK 241
            ::|.|.||...:..||.|.:.||.|..|:.|...:||.:|:..:|::...:.:||:.|:.|||||
Zfish    85 IKLKEIFETPAEISLVLELVTGGELFDRVVEKGYYSERDAADAVKQVLEAVAYLHENGVVHRDLK 149

  Fly   242 PENILCVKTDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHY 306
            |||:|...:....|:||.||.|...:.....:.:...||         .:.|||::     ....
Zfish   150 PENLLYATSAPDAPLKIADFGLSKIVDDQVTMKTVCGTP---------GYCAPEIL-----RGCA 200

  Fly   307 YDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHD 371
            |....|:||:|||.||||||:.||..:.|:...:.|..||              .:.|....|.:
Zfish   201 YGPEVDMWSVGVITYILLCGFEPFFDDRGDQYMFKRILNC--------------EYEFVSPWWDN 251

  Fly   372 VSDEAKDLISNLLVKKASNRLSAEAVLNHPWI 403
            ||..||||:..|:|:....||:.:..|.|||:
Zfish   252 VSLNAKDLVKKLIVQDPKKRLTTQQALQHPWV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 92/287 (32%)
S_TKc 117..403 CDD:214567 92/285 (32%)
camk4NP_001017607.1 STKc_CaMKIV 25..318 CDD:270987 93/291 (32%)
Pkinase 29..283 CDD:278497 92/285 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.