DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and CaMKII

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001162833.1 Gene:CaMKII / 43828 FlyBaseID:FBgn0264607 Length:531 Species:Drosophila melanogaster


Alignment Length:379 Identity:115/379 - (30%)
Similarity:177/379 - (46%) Gaps:67/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHAR--------ARVFREVETFHH 169
            |.:.|.:..| ||:||::.|:.||...|..|:|.|:|:.....||        ||:.|::.    
  Fly    10 FSDNYDIKEE-LGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLH---- 69

  Fly   170 CQGHLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKG 234
               |..|::|.:..:::...||||:.:.||.|...|.....:||.:||..|::|...::..|:.|
  Fly    70 ---HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNG 131

  Fly   235 IAHRDLKPENILCVKTDSLCPIKICDFDLGSGIKFTTDISS---PAATPQLLTPVGSAEFMAPEV 296
            :.||||||||:|.........:|:.||  |..|:...|..:   .|.||         .:::|||
  Fly   132 VVHRDLKPENLLLASKAKGAAVKLADF--GLAIEVQGDHQAWFGFAGTP---------GYLSPEV 185

  Fly   297 VDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGH 361
            :     :...|.|..|:|:.|||.||||.|||||         |:..      |..|:..|:.|.
  Fly   186 L-----KKEPYGKSVDIWACGVILYILLVGYPPF---------WDED------QHRLYSQIKAGA 230

  Fly   362 FSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEPPAS------------K 414
            :.:|..||..|:.|||:||:.:|....:.|::|...|.||||  |::|..||            |
  Fly   231 YDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPWI--CQRERVASVVHRQETVDCLKK 293

  Fly   415 HGRRHK---ALQTPSNIRRNHQSAREISQFAESAMAVKRVVLQHFSMRYDYMKE 465
            ...|.|   |:.|.....||..|...|::..|.:...:.......::..|.:||
  Fly   294 FNARRKLKGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 95/298 (32%)
S_TKc 117..403 CDD:214567 95/296 (32%)
CaMKIINP_001162833.1 STKc_CaMKII 12..303 CDD:270988 104/331 (31%)
S_TKc 14..272 CDD:214567 95/296 (32%)
CaMKII_AD 390..517 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.