DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and CaMKI

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:470 Identity:141/470 - (30%)
Similarity:208/470 - (44%) Gaps:102/470 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KEEMQKKRRKKRISSSLHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLE-YAVKVIDK--IP 153
            |::..||.:.|.:.......:.:|.|.|.| :||.||::.|:...:..:..| :|||:|||  :.
  Fly     6 KKDSGKKAKAKDLKELNKQVSIEEKYNLHG-LLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALK 69

  Fly   154 GHARA-----RVFREVETFHHCQG---------HLGILQLIEFFEDDEKFYLVFEKINGGPLLSR 204
            |...:     ||.|.... :|..|         |..|:||:|.:||..|.|||.|.:.||.|..|
  Fly    70 GKEESLENEIRVLRRFSA-NHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDR 133

  Fly   205 IQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILCVKTDSLCPIKICDFDLG----S 265
            |.|...::|.:||.:|::|...:|::|::|:.||||||||:|....|....|.|.||.|.    |
  Fly   134 IVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDS 198

  Fly   266 GIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPF 330
            ||              :.|..|:..::||||:     ....|.|..|:||:|||:||||||||||
  Fly   199 GI--------------MATACGTPGYVAPEVL-----AQKPYGKAVDVWSIGVISYILLCGYPPF 244

  Fly   331 SGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAE 395
                       ..||    ...||..|.:|.|.|....|.::|:.||..|.||:......|.:.:
  Fly   245 -----------YDEN----DANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCK 294

  Fly   396 AVLNHPWIRMCEQEPPASK---HGRRHKALQTPSNIRRNHQSAREISQFAESAMAVKRVVLQHFS 457
            ..|.|.||...|    ||.   ||      .....:::|...:| ..|...:|..::::      
  Fly   295 QALGHAWISGNE----ASSRNIHG------TVSEQLKKNFAKSR-WKQAYYAATVIRQM------ 342

  Fly   458 MRYDYMKERPNIYQPSQAYMDAYSDENYNPKPP----GHYTRN--RSQRNPASSLCGYGGRMSSM 516
                   :|..:...|.|..|:.:..|.:...|    |.:|.|  .||::..|            
  Fly   343 -------QRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQS------------ 388

  Fly   517 HGQRANSRRSSRNAS 531
            |.|..|....|.||:
  Fly   389 HAQEMNKSGGSTNAA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 108/308 (35%)
S_TKc 117..403 CDD:214567 107/306 (35%)
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 108/309 (35%)
S_TKc 31..302 CDD:214567 107/306 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.