DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and CG17528

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster


Alignment Length:341 Identity:105/341 - (30%)
Similarity:167/341 - (48%) Gaps:70/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EVERQAELNRHKEEMQKKRRKKRISSSLHSSTFQELYKL---------TGEILGEGAYASVQTCV 136
            :.|...|.:||              ::|.:||..|:.:|         .|.|:|:|.:|.|....
  Fly   445 KAETTPEDDRH--------------AALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIK 495

  Fly   137 NIYTDLEYAVKVID--KIPG-----HARARVFREVETFHHCQGHLGILQLIEFFEDDEKFYLVFE 194
            :..|...||:|:||  |..|     .|..||.:::       .|..|:.||...:.:...|||.|
  Fly   496 HRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKL-------NHPHIISLILSVDQNTNMYLVLE 553

  Fly   195 KINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILCVKTD---SLCPI 256
            .::||.|...|.:...|||:::..:|:.:.:.:.:||..||.|||:||||:| ||.|   ::..:
  Fly   554 YVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLL-VKLDEHGNVLEL 617

  Fly   257 KICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRCDLWSLGVIAY 321
            |:.||.|...:   .|:        |....|:..::|||:: |.||    |..:.|:|:.|:|.|
  Fly   618 KLADFGLACEV---NDL--------LYAVCGTPTYVAPEIL-LEVG----YGLKIDVWAAGIILY 666

  Fly   322 ILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEAKDLISNLLVK 386
            |||||:|||.....:             ||.||::|..|.:.||:..|.|:.|..:|||:|:|..
  Fly   667 ILLCGFPPFVAPDNQ-------------QEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQA 718

  Fly   387 KASNRLSAEAVLNHPW 402
            ....|.::|.:|:|.|
  Fly   719 DPDVRFTSEDILDHSW 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 98/307 (32%)
S_TKc 117..403 CDD:214567 97/305 (32%)
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 95/293 (32%)
S_TKc 477..734 CDD:214567 95/293 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24349
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.