DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Dclk3

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001178729.1 Gene:Dclk3 / 316023 RGDID:1309232 Length:807 Species:Rattus norvegicus


Alignment Length:446 Identity:120/446 - (26%)
Similarity:202/446 - (45%) Gaps:75/446 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NNNNN-----------NHPRG---------SGDSGIRSGSGISCSNTDNSC--------SQSQSD 55
            |||::           :||:|         .|...:..|:..:..::.::|        .:.|..
  Rat   386 NNNSDKKESRGSEAQESHPQGVAKAQKDLMEGLPAVEEGAVDARRDSRHTCRIKHAAWLRREQQA 450

  Fly    56 GQNELTRYSSEDVSGNESSEAPNM---TEVERQAELNRHKEEMQKKRRKKRISSSLHSSTFQELY 117
            ...:|.|...|:.......::..:   ..:|::::....:...::...:|...:.:.|:..::.|
  Rat   451 EPPQLPRTRGEEKEAEHEKKSGGLGGRRMLEKESKTKPEENRPERPSGRKLRPTGIISADVEKHY 515

  Fly   118 KLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHARARVFREVETFHHCQGHLGILQLIEF 182
            .: |.::|:|.:|.|:.|.:..|...||:|:|||.....:..:............|..|::|.|.
  Rat   516 DI-GRVIGDGNFAIVKECKHRETRQAYAMKIIDKSQLKGKEDIVDSEILIIQSLSHPNIVKLHEV 579

  Fly   183 FEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILC 247
            :|.:.:.||:.|.:.||.|...|.|.:.|.|.:|:.:|.::...|..:|.|.|.||||||||:|.
  Rat   580 YETEAEIYLIMEYVQGGDLFDAIIESVKFPEPDAAVMITDLCKALVHMHDKKIVHRDLKPENLLV 644

  Fly   248 VKT-DSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRC 311
            .:. |....:|:.||.|...:           ...:.|..|:..::|||::     ....|....
  Rat   645 QRNEDKSTTLKLADFGLAKHV-----------VRPIFTVCGTPTYVAPEIL-----SEKGYGLEV 693

  Fly   312 DLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEA 376
            |:|:.|||.||||||:|||             .:....|:.||..||.|.|.|....|.::||.|
  Rat   694 DMWAAGVILYILLCGFPPF-------------RSPERDQDELFNIIQLGQFEFLSPYWDNISDAA 745

  Fly   377 KDLISNLLVKKASNRLSAEAVLNHPWIRMC---------EQEPPASKHGR---RHK 420
            |||:.||||.....|.:|..||:||||.|.         ::|.|:|: ||   :||
  Rat   746 KDLVRNLLVVDPKKRYTAHQVLHHPWIGMVGHPSTVNPQKEESPSSE-GRFQSQHK 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 94/288 (33%)
S_TKc 117..403 CDD:214567 94/286 (33%)
Dclk3NP_001178729.1 UBQ 92..177 CDD:294102
PKc_like 514..771 CDD:304357 93/286 (33%)
S_TKc 515..772 CDD:214567 94/286 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.