DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Camk1d

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001100835.1 Gene:Camk1d / 307124 RGDID:1560691 Length:385 Species:Rattus norvegicus


Alignment Length:364 Identity:120/364 - (32%)
Similarity:172/364 - (47%) Gaps:62/364 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RKKRISSSLHSSTFQELYKL--TGEILGEGAYASVQTCVNIYTDLEYAVKVIDK--IPGHARA-- 158
            |:...|||......:::.|:  ..|.||.||::.|.......|...:|||.|.|  :.|...:  
  Rat     3 RENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIE 67

  Fly   159 ---RVFREVETFHHCQGHLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQII 220
               .|.|:::       |..|:.|.:.:|.....|||.:.::||.|..||.|...::|.:||.:|
  Rat    68 NEIAVLRKIK-------HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLI 125

  Fly   221 KEIASGLDFLHKKGIAHRDLKPENILCVKTDSLCPIKICDFDL----GSGIKFTTDISSPAATPQ 281
            :::...:.:||:.||.||||||||:|....|....|.|.||.|    |.|     |:.|      
  Rat   126 RQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKG-----DVMS------ 179

  Fly   282 LLTPVGSAEFMAPEVVDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENC 346
              |..|:..::||||:     ....|.|..|.||:||||||||||||||           ..|| 
  Rat   180 --TACGTPGYVAPEVL-----AQKPYSKAVDCWSIGVIAYILLCGYPPF-----------YDEN- 225

  Fly   347 RTCQELLFESIQEGHFSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEPP 411
               ...|||.|.:..:.|....|.|:||.|||.|.||:.|..:.|.:.|....||||   ..:..
  Rat   226 ---DSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWI---AGDTA 284

  Fly   412 ASKHGRRHKALQTPSNIRRNHQSAREISQFAESAMAVKR 450
            .||:  .|:::.  :.||:|...::....|  :|.||.|
  Rat   285 LSKN--IHESVS--AQIRKNFAKSKWRQAF--NATAVVR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 103/300 (34%)
S_TKc 117..403 CDD:214567 103/298 (35%)
Camk1dNP_001100835.1 STKc_CaMKI_delta 12..312 CDD:271070 112/348 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.