DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Mylk

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001099344.2 Gene:Mylk / 288057 RGDID:1310915 Length:1961 Species:Rattus norvegicus


Alignment Length:670 Identity:157/670 - (23%)
Similarity:275/670 - (41%) Gaps:149/670 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EPKSGTAASAAAAKASNNNNNNHPRGSGDSGIRSGSGISCSNTD------------NSCSQSQSD 55
            :|.:||..      ||:..:::.......|....||.:...|.:            .:|..:..:
  Rat  1375 DPPAGTPC------ASDIRSSSLTLSWYGSSYDGGSAVQSYNVEIWDTEDKVWTELATCRSTSFN 1433

  Fly    56 GQNELT------RYSSEDVSG-NESSEAPNMTEVERQAELNRHKEEMQKKRRKK-----RISSSL 108
            .|:.|.      |..:.:|.| :|.|:...:|.|..:.|..:.:.|:.....|:     |..:..
  Rat  1434 VQDLLPDREYKFRVRAVNVYGTSEPSQESELTAVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTVN 1498

  Fly   109 HSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHARARVFREVETFHHCQGH 173
            ......::|.:. |.||.|.:..|...|...|...:|.|.........:..:.:|: :..:|..|
  Rat  1499 TEQKVSDVYDIE-ERLGSGKFGQVFRLVEKRTGKIWAGKFFKAYSAKEKENIRQEI-SIMNCLHH 1561

  Fly   174 LGILQLIEFFEDDEKFYLVFEKINGGPLLSR-IQEHICFSEHEASQIIKEIASGLDFLHKKGIAH 237
            ..::|.::.||:.....:|.|.::||.|..| |.|....:|.|..:.:::|:.|::::||:||.|
  Rat  1562 PKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVH 1626

  Fly   238 RDLKPENILCV-KTDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLF- 300
            .|||||||:|| ||.:  .||:.||.|...::....:.....||         ||:||||::.. 
  Rat  1627 LDLKPENIMCVNKTGT--RIKLIDFGLARRLENAGSLKVLFGTP---------EFVAPEVINYEP 1680

  Fly   301 VGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFP 365
            :|.|      .|:||:|||.|||:.|..||.|:       |..|.        ..::....:.|.
  Rat  1681 IGYA------TDMWSIGVICYILVSGLSPFMGD-------NDNET--------LANVTSATWDFD 1724

  Fly   366 EAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEPPASKHGR-RHKALQTPSNIR 429
            :..:.::|::|||.|||||.|...|||.....|.|||:....:...|.|..: |.|........:
  Rat  1725 DEAFDEISEDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQ 1789

  Fly   430 RNHQSAREISQFAESAMAVKRVVLQHFSMR------------YDYMKERPNIYQPSQAYMDAYSD 482
            :...:.|.|.:.:..||      :...|.|            .:.::...::   |||:::|.::
  Rat  1790 KTGNAVRAIGRLSSMAM------ISGLSGRKSSTGSPTSPINAEKLESEEDV---SQAFLEAVAE 1845

  Fly   483 ENYNPKPPGHYTRNRSQRNPASSLCGYGGRMSSMHGQRANSRRSSRNASRNASAI--YPNSG--G 543
            |..:.||  ::::....             :..:.|          :|:|....|  ||:..  .
  Rat  1846 EKPHVKP--YFSKTIRD-------------LEVVEG----------SAARFDCKIEGYPDPEVVW 1885

  Fly   544 FKTLNVHEEDDDDEGLEAFGH--IDDDDEWSRS--------RREYQQQCE---TLGE-------- 587
            ||         ||:.:....|  ||.|::.:.|        ..:.:..|:   :|||        
  Rat  1886 FK---------DDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELI 1941

  Fly   588 -DRFRRQSGSEGDEVEDDED 606
             :......|.||.|.|::|:
  Rat  1942 VETMEEGEGEEGGEEEEEEE 1961

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 91/290 (31%)
S_TKc 117..403 CDD:214567 91/288 (32%)
MylkNP_001099344.2 I-set 42..132 CDD:254352
Ig 64..129 CDD:143165
I-set 165..254 CDD:254352
Ig 183..251 CDD:143165
23ISL 255..408 CDD:293226
I-set 410..500 CDD:254352
Ig 427..497 CDD:143165
I-set 510..596 CDD:254352
IGc2 523..586 CDD:197706
I-set 619..708 CDD:254352
Ig 636..704 CDD:143165
I-set 717..805 CDD:254352
Ig 720..805 CDD:299845
I-set 1141..1230 CDD:254352
IGc2 1154..1220 CDD:197706
Ig 1281..1378 CDD:299845 1/2 (50%)
I-set 1281..1370 CDD:254352
FN3 1374..1465 CDD:238020 17/95 (18%)
STKc_MLCK1 1504..1762 CDD:271093 91/291 (31%)
Pkinase 1507..1762 CDD:278497 91/288 (32%)
I-set 1852..1942 CDD:254352 20/123 (16%)
IGc2 1865..1932 CDD:197706 16/85 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.