DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Camkv

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_663596.1 Gene:Camkv / 235604 MGIID:2384296 Length:512 Species:Mus musculus


Alignment Length:291 Identity:84/291 - (28%)
Similarity:130/291 - (44%) Gaps:44/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 HLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAH 237
            |..||||::.|...:::::..|...|..:...|.:...:||.:.|.:::::...:.:||...|.|
Mouse    79 HPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLKIVH 143

  Fly   238 RDLKPENILCVKTDSLCPIKICDFDLG---SGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDL 299
            |:||.||::.........|.|.||.|.   :|:     |..|..||         |::|||||. 
Mouse   144 RNLKLENLVYYNRLKNSKIVISDFHLAKLENGL-----IKEPCGTP---------EYLAPEVVG- 193

  Fly   300 FVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSF 364
                ...|.:..|.|::|||.||||.|.|||.....||...|..:|       ||..|..|.:.|
Mouse   194 ----RQRYGRPVDCWAIGVIMYILLSGNPPFYEEVEEDDYENHDKN-------LFRKILAGDYEF 247

  Fly   365 PEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIR------------MCEQEPPASKHGR 417
            ....|.|:|..||||::.|:..:...|::||..::|.||.            :|.|........:
Mouse   248 DSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGVCAQIEKNFARAK 312

  Fly   418 RHKALQTPS---NIRRNHQSAREISQFAESA 445
            ..||::..:   .:|...||....:|.|..|
Mouse   313 WKKAVRVTTLMKRLRAPEQSGTAATQSASDA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 72/232 (31%)
S_TKc 117..403 CDD:214567 72/232 (31%)
CamkvNP_663596.1 STKc_CaMK_like 22..286 CDD:270990 72/232 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..347 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..512
DUF5585 397..>511 CDD:375359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.