DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Camk1

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:XP_006237061.1 Gene:Camk1 / 171503 RGDID:629473 Length:414 Species:Rattus norvegicus


Alignment Length:284 Identity:99/284 - (34%)
Similarity:140/284 - (49%) Gaps:33/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 EILGEGAYASVQTCVNIYTDLEYAVKVIDK--IPGHARARVFREVETFHHCQGHLGILQLIEFFE 184
            ::||.||::.|....:..|....|:|.|.|  :.| ....:..|:...|..: |..|:.|.:.:|
  Rat    55 DVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEG-KEGSMENEIAVLHKIK-HPNIVALDDIYE 117

  Fly   185 DDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILCVK 249
            .....||:.:.::||.|..||.|...::|.:||::|.::...:.:||..||.||||||||:|...
  Rat   118 SGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYS 182

  Fly   250 TDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRCDLW 314
            .|....|.|.||.|       :.:..|.:.  |.|..|:..::||||:     ....|.|..|.|
  Rat   183 LDEDSKIMISDFGL-------SKMEDPGSV--LSTACGTPGYVAPEVL-----AQKPYSKAVDCW 233

  Fly   315 SLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEAKDL 379
            |:||||||||||||||           ..||    ...|||.|.:..:.|....|.|:||.|||.
  Rat   234 SIGVIAYILLCGYPPF-----------YDEN----DAKLFEQILKAEYEFDSPYWDDISDSAKDF 283

  Fly   380 ISNLLVKKASNRLSAEAVLNHPWI 403
            |.:|:.|....|.:.|..|.||||
  Rat   284 IRHLMEKDPEKRFTCEQALQHPWI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 97/282 (34%)
S_TKc 117..403 CDD:214567 97/282 (34%)
Camk1XP_006237061.1 STKc_CaMKI_alpha 47..309 CDD:271069 99/284 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.