DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and DCX

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_000546.2 Gene:DCX / 1641 HGNCID:2714 Length:441 Species:Homo sapiens


Alignment Length:440 Identity:87/440 - (19%)
Similarity:134/440 - (30%) Gaps:150/440 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 KTLNVHEEDDDDEGLEAFGHIDDDDEWSRSRR----------EYQQQCE---------------- 583
            ::|..|:..:.|     |||.|:.|:.||:.|          .:...|.                
Human    74 QSLRFHQNMELD-----FGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKA 133

  Fly   584 ------------------TLGEDRFRRQSGSEGDEVEDDEDGENEDYQHYKHYWRELDEEEGDDY 630
                              .:..||||.......|......|              .::..:|..|
Human   134 KKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSD--------------NINLPQGVRY 184

  Fly   631 LYEQQQRVDD--KFGE-EEFEDEPKEETQADNLKLSKAYVEQVG---ETNVEKSKPQDDNGGYIR 689
            :|    .:|.  |.|. :|.|:.......:||......|.:.|.   ..||:.|.          
Human   185 IY----TIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSA---------- 235

  Fly   690 EDLIMDNMDMKKNTQQSEFAKLTIMRNDAQTEENK---------IMQQQDEEKKEEKQQDDVDGA 745
                  ||...::...|         |.||..|||         |::...:.:|..:    |...
Human   236 ------NMKAPQSLASS---------NSAQARENKDFVRPKLVTIIRSGVKPRKAVR----VLLN 281

  Fly   746 KKQGPSSDISATTITDNNKLQTPV-----------MTTTHINNWQTGDAIEDDDVKLLDSISDLN 799
            ||...|.:...|.||:..||:|.|           :|..|       |...||||    .|:...
Human   282 KKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLH-------DFFGDDDV----FIACGP 335

  Fly   800 EKLPEIYETANIVVNSAAV----PAAST-PAASATRPPTDNPEEDDSNVTK-PTTTAEGTTMQTT 858
            ||.....:..::..|...|    |:|:. |.||.|...|..........:| |..:|.||: .:.
Human   336 EKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTS-SSQ 399

  Fly   859 FGMSAEEEKPVALSHTAGHHSKTGRTVNFAPDAYQNDEDADIDEDDDYDD 908
            ......::.|::...:.|...|       ..|.|.   ...:|:.|...|
Human   400 LSTPKSKQSPISTPTSPGSLRK-------HKDLYL---PLSLDDSDSLGD 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992
S_TKc 117..403 CDD:214567
DCXNP_000546.2 DCX 129..219 CDD:214711 16/107 (15%)
DCX 256..344 CDD:214711 23/102 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.