DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Phkg2

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_542151.1 Gene:Phkg2 / 140671 RGDID:620024 Length:406 Species:Rattus norvegicus


Alignment Length:395 Identity:114/395 - (28%)
Similarity:175/395 - (44%) Gaps:62/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 EILGEGAYASVQTCVNIYTDLEYAVKVID--------KIPGHARARVFREVETFHHCQGHLGILQ 178
            :|:|.|..:.|:.||:..|..|:|||:::        :.....|....||:.......||..|:.
  Rat    28 DIIGRGVSSVVRRCVHRATGDEFAVKIMEVSAERLSLEQLEEVRDATRREMHILRQVAGHPHIIT 92

  Fly   179 LIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPE 243
            ||:.:|.....:|||:.:..|.|...:.|.:..||.|...|::.:...::|||...|.|||||||
  Rat    93 LIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVNFLHVNNIVHRDLKPE 157

  Fly   244 NILCVKTDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAH-YY 307
            |||   .|....|::.||.....::....:.....||         .::|||::...:.|.| .|
  Rat   158 NIL---LDDNMQIRLSDFGFSCHLEPGEKLRELCGTP---------GYLAPEILKCSMDETHPGY 210

  Fly   308 DKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDV 372
            .|..|||:.|||.:.||.|.|||         |:|.      |.|:...|.||.:.|...||.|.
  Rat   211 GKEVDLWACGVILFTLLAGSPPF---------WHRR------QILMLRMIMEGQYQFSSPEWDDR 260

  Fly   373 SDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEPPASKHGRRHKALQTPSNIRRNHQSARE 437
            |:..||||:.||....:.||:||..|.||:...|:...|.:         .||   |:..:.|  
  Rat   261 SNTVKDLIAKLLQVDPNARLTAEQALQHPFFERCKGSQPWN---------LTP---RQRFRVA-- 311

  Fly   438 ISQFAESAMAVKRVVLQHFSMR---YDYMKERPNIYQPSQAYMDAYSDENYNPKPPGHYTRNRSQ 499
                ..:.:|..||.|....:|   .:.:...|...:|.:..:|..:...|     ||:.:...|
  Rat   312 ----VWTILAAGRVALSSHRLRPLTKNALLRDPYALRPVRRLIDNCAFRLY-----GHWVKKGEQ 367

  Fly   500 RNPAS 504
            :|.|:
  Rat   368 QNRAA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 94/289 (33%)
S_TKc 117..403 CDD:214567 94/289 (33%)
Phkg2NP_542151.1 STKc_PhKG2 13..291 CDD:271083 94/289 (33%)
Calmodulin-binding (domain-N). /evidence=ECO:0000250 306..330 5/29 (17%)
Calmodulin-binding (domain-C). /evidence=ECO:0000250 346..370 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.