DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and PNCK

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001034671.3 Gene:PNCK / 139728 HGNCID:13415 Length:426 Species:Homo sapiens


Alignment Length:399 Identity:112/399 - (28%)
Similarity:167/399 - (41%) Gaps:59/399 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PNMTEVERQAE----LNRHKEEMQKKRRKKRISSSLHSSTFQELYKLTGEILGEGAYASVQTCVN 137
            |.:.|..|.:.    ..||...:.....:..:....|:.....:|::. |.||.||::.|.....
Human    54 PQLREAARASSGLGGGGRHPSRIPAIALQDMLLLKKHTEDISSVYEIR-ERLGSGAFSEVVLAQE 117

  Fly   138 IYTDLEYAVKVIDK--IPGHARARVFREVETFHHCQGHLGILQLIEFFEDDEKFYLVFEKINGGP 200
            ..:....|:|.|.|  :.| ..|.|..|:...... .|..|:.|.:..|.....||..|.:.||.
Human   118 RGSAHLVALKCIPKKALRG-KEALVENEIAVLRRI-SHPNIVALEDVHESPSHLYLAMELVTGGE 180

  Fly   201 LLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILCVKTDSLCPIKICDFDLGS 265
            |..||.|...::|.:||.::.::...:.:||..||.||||||||:|.........|.:.||.|  
Human   181 LFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGL-- 243

  Fly   266 GIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPF 330
                    |...|...|.|..|:..::|||::     |...|.|..|:|:||||:||||||||||
Human   244 --------SKIQAGNMLGTACGTPGYVAPELL-----EQKPYGKAVDVWALGVISYILLCGYPPF 295

  Fly   331 SGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAE 395
            ......:               ||..|....:.|....|.|:|:.|||.|.:||.:....|.:.:
Human   296 YDESDPE---------------LFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQ 345

  Fly   396 AVLNHPWI------------RMCEQ--EPPASKHGRRHKALQTPSNIRRNHQSAREISQFAESAM 446
            ..|.|.||            .:.||  :..|..|.:|  |....|.:|.    .|::.|..|...
Human   346 QALRHLWISGDTAFDRDILGSVSEQIRKNFARTHWKR--AFNATSFLRH----IRKLGQIPEGEG 404

  Fly   447 AVKRVVLQH 455
            |.::.:.:|
Human   405 ASEQGMARH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 91/289 (31%)
S_TKc 117..403 CDD:214567 91/287 (32%)
PNCKNP_001034671.3 STKc_CaMKI_beta 94..370 CDD:271071 93/308 (30%)
S_TKc 98..353 CDD:214567 91/287 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.