DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Dcx

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001103692.1 Gene:Dcx / 13193 MGIID:1277171 Length:366 Species:Mus musculus


Alignment Length:386 Identity:76/386 - (19%)
Similarity:115/386 - (29%) Gaps:148/386 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 FGHIDDDDEWSRSRR----------EYQQQCE--------------------------------- 583
            |||.|:.|:.||:.|          .:...|.                                 
Mouse     5 FGHFDERDKASRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIV 69

  Fly   584 -TLGEDRFRRQSGSEGDEVEDDEDGENEDYQHYKHYWRELDEEEGDDYLYEQQQRVDD--KFGE- 644
             .:..||||.......|......|              .::..:|..|:|    .:|.  |.|. 
Mouse    70 YAVSSDRFRSFDALLADLTRSLSD--------------NINLPQGVRYIY----TIDGSRKIGSM 116

  Fly   645 EEFEDEPKEETQADNLKLSKAYVEQVG---ETNVEKSKPQDDNGGYIREDLIMDNMDMKKNTQQS 706
            :|.|:.......:||......|.:.|.   ..||:.|.                ||...::...|
Mouse   117 DELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSA----------------NMKAPQSLASS 165

  Fly   707 EFAKLTIMRNDAQTEENK---------IMQQQDEEKKEEKQQDDVDGAKKQGPSSDISATTITDN 762
                     |.||..|||         |::...:.:|..:    |...||...|.:...|.||:.
Mouse   166 ---------NSAQARENKDFVRPKLVTIIRSGVKPRKAVR----VLLNKKTAHSFEQVLTDITEA 217

  Fly   763 NKLQTPV-----------MTTTHINNWQTGDAIEDDDVKLLDSISDLNEKLPEIYETANIVVNSA 816
            .||:|.|           :|..|       |...||||    .|:...||.....:..::..|..
Mouse   218 IKLETGVVKKLYTLDGKQVTCLH-------DFFGDDDV----FIACGPEKFRYAQDDFSLDENEC 271

  Fly   817 AV-----PAASTPAASAT---------------RPPTDNPEEDDSNVTKPTTTAEGTTMQT 857
            .|     .||:.|.||.|               :.|.|:..:.|:|.|..:..:...:.|:
Mouse   272 RVMKGNPSAAAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992
S_TKc 117..403 CDD:214567
DcxNP_001103692.1 DCX1_DCX 51..139 CDD:340529 16/105 (15%)
DCX2 176..259 CDD:340589 23/97 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..366 12/58 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.