DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and Camk2a

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:XP_006525604.1 Gene:Camk2a / 12322 MGIID:88256 Length:489 Species:Mus musculus


Alignment Length:302 Identity:99/302 - (32%)
Similarity:149/302 - (49%) Gaps:36/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SSLHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVID--KIPGHARARVFREVETFH 168
            :::..:.|.|.|:|..| ||:||::.|:.||.:....|||.|:|:  |:......::.||...  
Mouse     2 ATITCTRFTEEYQLFEE-LGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARI-- 63

  Fly   169 HCQ--GHLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLH 231
             |:  .|..|::|.:...::...||:|:.:.||.|...|.....:||.:||..|::|...:...|
Mouse    64 -CRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCH 127

  Fly   232 KKGIAHRDLKPENILCVKTDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEV 296
            :.|:.||||||||:|.........:|:.||.|.        |.............|:..:::|||
Mouse   128 QMGVVHRDLKPENLLLASKLKGAAVKLADFGLA--------IEVEGEQQAWFGFAGTPGYLSPEV 184

  Fly   297 VDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGH 361
            :     ....|.|..|||:.|||.||||.|||||         |:..      |..|::.|:.|.
Mouse   185 L-----RKDPYGKPVDLWACGVILYILLVGYPPF---------WDED------QHRLYQQIKAGA 229

  Fly   362 FSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWI 403
            :.||..||..|:.||||||:.:|....|.|::|...|.||||
Mouse   230 YDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 96/291 (33%)
S_TKc 117..403 CDD:214567 95/289 (33%)
Camk2aXP_006525604.1 STKc_CaMKII 11..302 CDD:270988 98/293 (33%)
CaMKII_AD 357..484 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.