DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and pskh2

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:XP_002939203.3 Gene:pskh2 / 100497280 XenbaseID:XB-GENE-957157 Length:414 Species:Xenopus tropicalis


Alignment Length:398 Identity:117/398 - (29%)
Similarity:188/398 - (47%) Gaps:73/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ERQAELNRHKEEMQKKRRK--KRISSSLHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYA 145
            :::.:|...|.::.:.|.|  .|:::.         |.:.. ::|.|:::.|....:..|...:|
 Frog    60 DQEHKLQSKKSQVARYRAKFDPRVTAR---------YDIKA-LIGRGSFSRVVRVEHRATRQPFA 114

  Fly   146 VKVIDKIPGHARARVFREVETFHHCQGHLGIL---------QLIEFFEDDEKFYLVFEKINGGPL 201
            :|:|:     ..|:..|||     |:..|.||         ||||.||..::.|:|.|...||.|
 Frog   115 IKMIE-----TSAKEGREV-----CESELNILRRVSHHYIIQLIEVFEARDRVYMVMELATGGEL 169

  Fly   202 LSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILCVKTDSLCPIKICDFDLGSG 266
            ..||.....|:|.:|:::::.:..|:.:||..||.||||||||:|.....:...|.:.||.|.:.
 Frog   170 FDRIIAKGSFTERDATKVLQMVLDGISYLHGLGITHRDLKPENLLYYHPGADSKILVTDFGLANS 234

  Fly   267 IKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFS 331
            .....|.|       :.|..|:.|::|||::     ....|....|:|:||||.||||.|..|| 
 Frog   235 GNKGGDWS-------MRTICGTPEYIAPEII-----LRRPYSNGVDMWALGVITYILLSGSMPF- 286

  Fly   332 GNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAEA 396
                ||      || ||   .|:..|.:|.:|:....|.:||:.|||.|..||...:::||||..
 Frog   287 ----ED------EN-RT---RLYRLILKGKYSYMGDPWPNVSNLAKDFIDRLLTVDSNDRLSASD 337

  Fly   397 VLNHPWIRMCEQEPPASKHGRRHKALQTPSNIRRN-----HQSAREIS----QFAESAMAVKRVV 452
            .:.|.||:..   ..:|.....|:::.  .|::|.     |.|..|.|    |..:|....:|.:
 Frog   338 AMKHSWIKTM---AASSSMKNLHRSIS--QNMKRRVSSRCHSSKSEHSSRSGQLNKSRRIREREI 397

  Fly   453 LQHFSMRY 460
            .:. ::||
 Frog   398 AER-NLRY 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 97/296 (33%)
S_TKc 117..403 CDD:214567 97/294 (33%)
pskh2XP_002939203.3 STKc_PSKH1 85..344 CDD:270989 97/305 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.