DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and si:ch73-60h1.1

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:XP_002663771.2 Gene:si:ch73-60h1.1 / 100332381 ZFINID:ZDB-GENE-140106-152 Length:438 Species:Danio rerio


Alignment Length:403 Identity:118/403 - (29%)
Similarity:177/403 - (43%) Gaps:59/403 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ISSSLHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHARARVFREVETFH 168
            :..|...:|.::.|.: |..||.||.:.|..|....|:..|||||:.|.......|.  |:....
Zfish    15 VDGSRRDATVEDFYNM-GPELGRGATSVVLRCEEKQTEKPYAVKVLKKTIDKKIVRT--EIGVLL 76

  Fly   169 HCQGHLGILQLIEFFEDDEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKK 233
            .. .|..|::|.|.||.:.:.:|:.|.:.||.|..||.|...:||.:|:.:||:|...:.:||:.
Zfish    77 RL-SHPNIIRLKEIFETETEIFLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHEN 140

  Fly   234 GIAHRDLKPENILCVKTDSLCPIKICDFDLGSGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVD 298
            |:.||||||||:|........|:||.||.|...|.....:.:...||         .:.|||:: 
Zfish   141 GVVHRDLKPENLLYADLSIDAPLKIADFGLSKIIDEQVTMKTVCGTP---------GYCAPEIL- 195

  Fly   299 LFVGEAHYYDKRCDLWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFS 363
                ..:.|....|:||:|||.||||||:.||....|:...::|..||              .:.
Zfish   196 ----RGNAYGPEVDMWSVGVILYILLCGFEPFFDQRGDQYMYSRILNC--------------DYE 242

  Fly   364 FPEAEWHDVSDEAKDLISNLLVKKASNRLSAEAVLNHPWIRMCEQEPPASKHGR--RHKALQTPS 426
            |....|.:||..||||::.|:|.....||:.:..|.|||:.           |:  |...:.|..
Zfish   243 FVSPWWDEVSLNAKDLVNKLIVLDPHKRLTVKQALEHPWVL-----------GKAARFSHMDTTQ 296

  Fly   427 NIRRNHQSAREISQFAESAMAVKRVVLQHFSMRYDYMKERPNIYQPSQAYMDAYSDENYNPKPPG 491
            ...:...:.|::....::.:|..|  :...|.|.....|.||..:.|  ...:...||       
Zfish   297 RKLQEFNARRKLKAAMKAVVATSR--MHEGSRRRTDSCEMPNTDKTS--CQSSIQKEN------- 350

  Fly   492 HYTRNRSQRNPAS 504
              |.| |.|.|.|
Zfish   351 --TTN-SSREPIS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 95/287 (33%)
S_TKc 117..403 CDD:214567 95/285 (33%)
si:ch73-60h1.1XP_002663771.2 STKc_CaMKIV 24..317 CDD:270987 100/335 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.