DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lk6 and XB22062963

DIOPT Version :9

Sequence 1:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster
Sequence 2:NP_001135626.1 Gene:XB22062963 / 100216185 XenbaseID:XB-GENE-22062964 Length:385 Species:Xenopus tropicalis


Alignment Length:349 Identity:97/349 - (27%)
Similarity:154/349 - (44%) Gaps:44/349 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GEILGEGAYASVQTCVNIYTDLEYAVKVIDKIPGHARARVFREVETFHHCQGHLGILQLIEFFED 185
            ||:|....:..:.....|.||..:..|...|..|....|..:...:......|..|||||:.||.
 Frog    27 GELLCAKEFCEICLAREIPTDRLFLCKKFLKKDGRKVRRAAKNEISILKLVNHPNILQLIDTFET 91

  Fly   186 DEKFYLVFEKINGGPLLSRIQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILCVKT 250
            .::||::.|...||.:...|.....:||.:||.:::::...:.:||...|.||:||.||::....
 Frog    92 KKEFYIIQELATGGDVFDWISAQGYYSERDASNVLRQLLEAVSYLHSLRIVHRNLKLENLMYYNQ 156

  Fly   251 DSLCPIKICDFDLG---SGIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRCD 312
            ::...:.:.||.|.   ||     :|:.|..||         |::|||||     ..|.|.:..|
 Frog   157 NNHSKVVLRDFYLSCFESG-----EITEPCGTP---------EYLAPEVV-----SRHRYGRPVD 202

  Fly   313 LWSLGVIAYILLCGYPPFSGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEAK 377
            .|::||:.:|||.|.|||...       |..||..:....:|..|..|.:.|....|..:|..||
 Frog   203 CWAVGVVMFILLSGNPPFYDE-------NEEENSESHNRKIFRKILAGEYEFDSPYWDVISASAK 260

  Fly   378 DLISNLLVKKASNRLSAEAVLNHPWIR------------MCEQEPPASKHGRRHKALQTPSNIRR 430
            ||:|.|:......|::|:..|.|.||.            :|.|........:..||::..:.::|
 Frog   261 DLVSRLMEMDQEQRITAQDALAHTWISGNAASERNLKEGVCAQIEKNFAKAKWRKAIRVTTFMQR 325

  Fly   431 NH--QSAREISQFAESAMAVKRVV 452
            ..  :.|| :.....|:|:|...|
 Frog   326 LRAPEGAR-LPVTPRSSMSVSHEV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 84/284 (30%)
S_TKc 117..403 CDD:214567 84/284 (30%)
XB22062963NP_001135626.1 PKc_like 22..286 CDD:304357 84/284 (30%)
S_TKc 24..286 CDD:214567 84/284 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.