DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and PHO4

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_116692.1 Gene:PHO4 / 850594 SGDID:S000001930 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:30/117 - (25%)
Similarity:52/117 - (44%) Gaps:27/117 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVKYESEAAVSSFPYCTES------------SLNFSTSATAYSEDDAEYATGRRNKTSRQDPLSH 67
            ||..::.::.......:||            ||:...|:.|..:||           .|:   ||
Yeast   205 PVTAKTSSSAEGVVVASESPVIAPHGSSHSRSLSKRRSSGALVDDD-----------KRE---SH 255

  Fly    68 RIIEKRRRDRMNSCLADLSRLIPPQY-QRKGRGRIEKTEIIEMAIRHLKHLQ 118
            :..|:.||:|:...|.:|:.|||.:: |:.......|...:|.|.|:::|||
Yeast   256 KHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 17/52 (33%)
ORANGE 126..168 CDD:128787
PHO4NP_116692.1 bHLH_ScPHO4_like 251..312 CDD:381398 20/60 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.