DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hes7

DIOPT Version :10

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:106 Identity:33/106 - (31%)
Similarity:52/106 - (49%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRNKTSRQDP-LSHRIIEKRRRDRMNSCLADLSRLI--PPQYQRKGRGRIEKTEIIEMAIRHLKH 116
            |....:|..| :...::|||||||:|..|.:|..|:  ..:.|.....::||.||:|.|:.:|:.
Mouse     4 RERAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRE 68

  Fly   117 L---------QSECQQKE---SDYRSGYMDCMKEAAKFLYD 145
            .         :|..|..|   |.|.||:.:|:...|.|.:|
Mouse    69 RSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHD 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 bHLH-O_Cwo_like 62..121 CDD:381446 21/70 (30%)
ORANGE 126..168 CDD:128787 8/20 (40%)
Hes7NP_149030.2 bHLH_SF 13..73 CDD:469605 20/59 (34%)
PRK14954 <96..>189 CDD:184918 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.