DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Bhlhe40

DIOPT Version :10

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_445780.2 Gene:Bhlhe40 / 79431 RGDID:68439 Length:411 Species:Rattus norvegicus


Alignment Length:114 Identity:33/114 - (28%)
Similarity:59/114 - (51%) Gaps:25/114 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRNKTSRQD-PLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLK--- 115
            :|::.|::. .|.||:|||:||||:|.|:|.|..|:|...:....|.:||..::|:.::|:|   
  Rat    44 KRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALT 108

  Fly   116 HLQSECQQK---------------------ESDYRSGYMDCMKEAAKFL 143
            :|..:.|||                     :..:.||:..|.:|..::|
  Rat   109 NLIDQQQQKIMALQSGLQAGDLSGRNIEAGQEMFCSGFQTCAREVLQYL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 bHLH-O_Cwo_like 62..121 CDD:381446 23/62 (37%)
ORANGE 126..168 CDD:128787 5/18 (28%)
Bhlhe40NP_445780.2 Essential for interaction with BMAL1, E-box binding and repressor activity against the CLOCK-BMAL1 heterodimer. /evidence=ECO:0000250 1..139 28/94 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
bHLH-O_DEC1 40..129 CDD:381592 28/84 (33%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 1/3 (33%)
ORANGE 140..184 CDD:128787 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..293
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.