DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hes5

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:111 Identity:31/111 - (27%)
Similarity:50/111 - (45%) Gaps:36/111 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIEKRRRDRMNSCLADLSRLIPPQYQR-KGRGRIEKTEIIEMAIRHLKHLQSE---C-------- 121
            ::||.||||:||.:..|..|:..::.| :...::||.:|:|||:.:|||.:.|   |        
  Rat    23 VVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGELGACARVLLPTG 87

  Fly   122 ------------------------QQKESDYRSGYMDCMKEAAKFL 143
                                    :....||..||..|::||.:||
  Rat    88 VAPTARAPLMPLGLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 20/49 (41%)
ORANGE 126..168 CDD:128787 9/18 (50%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 20/50 (40%)
ORANGE 116..158 CDD:128787 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.