DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and hes2.2

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001038818.1 Gene:hes2.2 / 751634 ZFINID:ZDB-GENE-060825-55 Length:172 Species:Danio rerio


Alignment Length:122 Identity:33/122 - (27%)
Similarity:58/122 - (47%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIEKRRRDRMNSCLADLSRLIPP-------QYQRKGRGRIEKTEIIEMAIRHLKHLQSECQQKES 126
            ::||:||.|:|..|..|..||.|       :|     .::||.:|:||.:|.|..:|:...:..:
Zfish    15 LLEKKRRARINDSLDRLKALILPLTGKDNCRY-----SKLEKADILEMTVRFLTDIQT
TPSKDTA 74

  Fly   127 -DYRSGYMDCMKEAAKFLYDVHMQ-DFCHRLLGRLQEHIDEMFKTD-----CYKSTR 176
             .:..||..|::..:..|....:. :..||:...:|..:  |.||.     |.:|:|
Zfish    75 VSFTEGYTTCLQRVSARLPQTSLDAETRHRVNDFIQRSV--MPKTPACQNCCAQSSR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 19/55 (35%)
ORANGE 126..168 CDD:128787 8/43 (19%)
hes2.2NP_001038818.1 HLH 6..67 CDD:238036 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573848
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.