DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and hes7

DIOPT Version :10

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001039166.1 Gene:hes7 / 733997 XenbaseID:XB-GENE-876465 Length:178 Species:Xenopus tropicalis


Alignment Length:145 Identity:38/145 - (26%)
Similarity:68/145 - (46%) Gaps:27/145 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SHR-----IIEKRRRDRMNSCLADLSRLIPPQ---YQRKGRGRIEKTEIIEMAIRHLKHLQSECQ 122
            :||     ::|:|||:|:|:.|..| |:...|   .::....::||.||:|..::.|:  .|:..
 Frog    12 AHRKLLKPLVERRRRERINNSLEKL-RIFLSQALKSEKLKNPKVEKAEILECTVQFLQ--SSKLV 73

  Fly   123 QKESD-----YRSGYMDCMKEAAKFL-----YDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRS 177
            .::.|     |:||:..|::.|..|:     .:|..:||....|...:...:....||..|.|.|
 Frog    74 PQDGDVGNKGYQSGFQHCLETALHFMNSKPDLNVATKDFLSHQLSSYKPPAEAWSPTDTPKPTPS 138

  Fly   178 CHMPDNVSASSGSPH 192
            ....|:      :||
 Frog   139 IGYQDS------APH 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 bHLH-O_Cwo_like 62..121 CDD:381446 19/62 (31%)
ORANGE 126..168 CDD:128787 11/51 (22%)
hes7NP_001039166.1 bHLH-O_HES7 14..74 CDD:381468 18/62 (29%)
Hairy_orange 84..121 CDD:462193 10/36 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..147 6/30 (20%)
WRPW motif. /evidence=ECO:0000255 174..177
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.