DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and hes5.9

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001037951.1 Gene:hes5.9 / 733709 XenbaseID:XB-GENE-22064044 Length:155 Species:Xenopus tropicalis


Alignment Length:48 Identity:16/48 - (33%)
Similarity:30/48 - (62%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIEKRRRDRMNSCLADLSRLIPPQYQRKG-RGRIEKTEIIEMAIRHLK 115
            ::||.||||:||.:..|..|:..:::... ..:.||.:|:|:|:..|:
 Frog    26 VVEKMRRDRINSSIEQLRMLLEKEFESHHLPSKPEKADILEVAVSLLR 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 16/48 (33%)
ORANGE 126..168 CDD:128787
hes5.9NP_001037951.1 bHLH-O_HES5 21..79 CDD:381467 16/48 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.