powered by:
Protein Alignment cwo and hes5.9
DIOPT Version :9
Sequence 1: | NP_524775.1 |
Gene: | cwo / 44669 |
FlyBaseID: | FBgn0259938 |
Length: | 698 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001037951.1 |
Gene: | hes5.9 / 733709 |
XenbaseID: | XB-GENE-22064044 |
Length: | 155 |
Species: | Xenopus tropicalis |
Alignment Length: | 48 |
Identity: | 16/48 - (33%) |
Similarity: | 30/48 - (62%) |
Gaps: | 1/48 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 IIEKRRRDRMNSCLADLSRLIPPQYQRKG-RGRIEKTEIIEMAIRHLK 115
::||.||||:||.:..|..|:..:::... ..:.||.:|:|:|:..|:
Frog 26 VVEKMRRDRINSSIEQLRMLLEKEFESHHLPSKPEKADILEVAVSLLR 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
cwo | NP_524775.1 |
HLH |
66..118 |
CDD:306515 |
16/48 (33%) |
ORANGE |
126..168 |
CDD:128787 |
|
hes5.9 | NP_001037951.1 |
bHLH-O_HES5 |
21..79 |
CDD:381467 |
16/48 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.