powered by:
Protein Alignment cwo and Hes3
DIOPT Version :9
Sequence 1: | NP_524775.1 |
Gene: | cwo / 44669 |
FlyBaseID: | FBgn0259938 |
Length: | 698 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_073178.1 |
Gene: | Hes3 / 64628 |
RGDID: | 621339 |
Length: | 175 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 23/69 - (33%) |
Similarity: | 40/69 - (57%) |
Gaps: | 6/69 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 IEKRRRDRMNSCLADLSRLIPPQYQRKGRGR-IEKTEIIEMAIRHLKHLQSECQ-----QKESDY 128
:||:||.|:|..|..|..|:...|..:.|.| :||.:|:|:::::::.||:..| ....||
Rat 1 MEKKRRARINLSLEQLRSLLERHYSHQIRKRKLEKADILELSVKYVRSLQNSLQGLWLVPSGVDY 65
Fly 129 RSGY 132
.||:
Rat 66 PSGF 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166334629 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4304 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.