DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and hey2

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_571697.2 Gene:hey2 / 58146 ZFINID:ZDB-GENE-000526-1 Length:324 Species:Danio rerio


Alignment Length:333 Identity:82/333 - (24%)
Similarity:134/333 - (40%) Gaps:70/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ATAYSEDDAEYATGRRNKTSRQDPLS-------------------HRIIEKRRRDRMNSCLADLS 86
            :|:.|:.|.....|..|..|.|...|                   ..|||||||||:|:.|::|.
Zfish     8 STSDSDMDETIDVGSENNYSGQSNGSFIRCGSPTTTSQVMARKKRRGIIEKRRRDRINNSLSELR 72

  Fly    87 RLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS-------ECQQKESDYRS-GYMDCMKEAAKFL 143
            ||:|..::::|..::||.||::|.:.|||.||:       :......|:.| |:.:|:.|.|::|
Zfish    73 RLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHSLAMDFLSIGFRECLTEVARYL 137

  Fly   144 YDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHMPDNVSASSGS--PHQ---AYHP-PLCHL 202
            ..|...|....|..||..|:     :.|.....:..|..:::....:  ||.   |.|| |...|
Zfish   138 SSVEGLDSSDPLRVRLVSHL-----SSCASQREAAAMTTSIAHHQQALHPHHWAAALHPIPAAFL 197

  Fly   203 RDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQQAAA---------------AAAVAAAAVA 252
            :.....|:............:..:..:|.:...|:....:               :|.|.|||.|
Zfish   198 QQSGLPSSESSSGRLSEAPQRGAALFSHSDSALRAPSTGSVAPCVPPLSTSLLSLSATVHAAAAA 262

  Fly   253 VANGSSPASNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSAAACAGGNSNSSGSNSSNAAS 317
            .|..:.|.|       .|       .|.|..:.:|.::|..|.:.::..   |.|:.|..|:.:|
Zfish   263 AAAQTFPLS-------FP-------AGFPLFSPSVTASSVASSTVSSSV---STSTTSQQSSGSS 310

  Fly   318 STICPPAG 325
            |....|.|
Zfish   311 SKPYRPWG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 25/70 (36%)
ORANGE 126..168 CDD:128787 13/42 (31%)
hey2NP_571697.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 7/25 (28%)
HLH 49..105 CDD:238036 25/55 (45%)
Hairy_orange 125..162 CDD:284859 12/41 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..324 8/28 (29%)
YRPW motif 314..317 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.