DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and HES4

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001135939.1 Gene:HES4 / 57801 HGNCID:24149 Length:247 Species:Homo sapiens


Alignment Length:171 Identity:52/171 - (30%)
Similarity:76/171 - (44%) Gaps:27/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ATGRRNKTSRQ---DPLSHR-IIEKRRRDRMNSCLADLSRLIPPQYQRKG--RGRIEKTEIIEMA 110
            |||.|.....|   ||.|.: ::|||||.|:|..||.|..||....:::.  ..::||.:|:||.
Human    46 ATGGREGRGTQPVPDPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMT 110

  Fly   111 IRHLKHLQ--------SECQQKESDYRSGYMDCMKEAAKFLYDVH--MQDFCHRLLGRLQEHIDE 165
            :|||:.|:        |........||:|:.:|:.|..:||....  ..|...||||.|      
Human   111 VRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHL------ 169

  Fly   166 MFKTDCYKSTRSCHMPDNVSASSGSPHQAYHPPLCHLRDML 206
               ..|.:.......|  .|.|..:|.:|..|.:...|.:|
Human   170 ---AACLRQLGPSRRP--ASLSPAAPAEAPAPEVYAGRPLL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 21/54 (39%)
ORANGE 126..168 CDD:128787 13/43 (30%)
HES4NP_001135939.1 HLH 62..119 CDD:238036 22/56 (39%)
Hairy_orange 136..174 CDD:284859 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.