DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and her8.2

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:224 Identity:57/224 - (25%)
Similarity:97/224 - (43%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SATAYSEDDAEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKT 104
            :||...::..:.....:.:...:.||    ||::||:|:|.||..|...:...: :..:.::||.
Zfish     4 TATKLQQNSCQLHISSKEERKLRKPL----IERKRRERINLCLDQLRETVVAVF-KPDQSKLEKA 63

  Fly   105 EIIEMAIRHLKHLQSECQQKESD----------YRSGYMDCMKEAAKFLYDVHMQDFCHRLLG-R 158
            :|:||.::||:::||   .:.||          |.:||:.||:|....|   |..|:..:.|| |
Zfish    64 DILEMTVKHLQNIQS---SRVSDPVLNTGARQRYSTGYIQCMQEVHNLL---HSCDWMDKTLGSR 122

  Fly   159 LQEHIDEMFKTDCYKSTRSC-HMPDNVSASSGSPHQAY---------HPPLCHLRDMLATSASDV 213
            |..|   :||: ...|.:.| .:|.....|..|.|..|         .|..|.....|....:  
Zfish   123 LLNH---LFKS-LPLSAKDCPRLPKTSLTSVPSDHSEYSSFHVDETASPKPCSSSPFLCKRPN-- 181

  Fly   214 EHSQDH-------NDVKDLSFRNHLNQLQ 235
            :....|       :||:.    :||:.||
Zfish   182 QSQNQHFTPIRMPHDVES----SHLSVLQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 16/51 (31%)
ORANGE 126..168 CDD:128787 16/52 (31%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 18/61 (30%)
Hairy_orange 94..132 CDD:284859 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.