DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Hes6

DIOPT Version :10

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_062352.1 Gene:Hes6 / 55927 MGIID:1859852 Length:224 Species:Mus musculus


Alignment Length:110 Identity:29/110 - (26%)
Similarity:56/110 - (50%) Gaps:24/110 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EDDAEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIP-PQYQRKGRGRIEKTEIIEM 109
            ::|.:....|.::.:|: ||    :||:||.|:|..|.:|..|:. .:.|.|    :|..|::|:
Mouse    14 QEDEDRWEARGDRKARK-PL----VEKKRRARINESLQELRLLLAGTEVQAK----LENAEVLEL 69

  Fly   110 AIRHL-----------KHLQSECQQKESDYRSGYMDCMKEAAKFL 143
            .:|.:           :.||:|..::   :.:||:.||.|...|:
Mouse    70 TVRRVQGALRGRAREREQLQAEASER---FAAGYIQCMHEVHTFV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 bHLH-O_Cwo_like 62..121 CDD:381446 19/70 (27%)
ORANGE 126..168 CDD:128787 6/18 (33%)
Hes6NP_062352.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/17 (18%)
bHLH_SF 24..81 CDD:469605 18/65 (28%)
Hairy_orange 95..134 CDD:462193 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..209
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.