DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and HES2

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:111 Identity:35/111 - (31%)
Similarity:52/111 - (46%) Gaps:27/111 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIEKRRRDRMNSCLADLSRLIPPQYQRKGR--GRIEKTEIIEMAIRHLKHLQSE---------CQ 122
            ::|||||.|:|..|:.|..||.|...|:..  .::||.:::||.:|.|:.|.:.         | 
Human    20 LLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPC- 83

  Fly   123 QKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRLL-----GRLQEHI 163
               ..||.||..|:...|:.|      ..| |:|     .||.||:
Human    84 ---DSYREGYSACVARLARVL------PAC-RVLEPAVSARLLEHL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 19/50 (38%)
ORANGE 126..168 CDD:128787 14/43 (33%)
HES2NP_061962.2 HLH 12..70 CDD:238036 19/49 (39%)
ORANGE 84..127 CDD:128787 14/43 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173
WRPW motif 170..173
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.