DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and Helt

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_008769494.1 Gene:Helt / 498633 RGDID:1564073 Length:241 Species:Rattus norvegicus


Alignment Length:351 Identity:83/351 - (23%)
Similarity:121/351 - (34%) Gaps:127/351 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQSE 120
            |.|..::.|:||::||||||||:|.||.:|.:.:|....::..|::||.||:||.:::|:.|.| 
  Rat     4 RLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHS- 67

  Fly   121 CQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTRSCHMPDNVS 185
                 :|:..|     :|.|:.|     .:|.:..                              
  Rat    68 -----ADFPRG-----REKAELL-----AEFANYF------------------------------ 87

  Fly   186 ASSGSPHQAYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQQAAAAAAVAAAA 250
                  |..||..:.:|...|.|    ||..    :.||..:...|..||...:..|..|.    
  Rat    88 ------HYGYHECMKNLVHYLTT----VERM----ETKDTKYARILAFLQSKARLGAEPAF---- 134

  Fly   251 VAVANGSSPASNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSA---AACAGGNSNSSGSNS 312
                   .|.|....|....|         .||....|.:|.|..:.   .|..|          
  Rat   135 -------PPLSLPEPDFSYQL---------HPAGPEFPGHSPGEATVFPQGATPG---------- 173

  Fly   313 SNAASSTICPPAGGSCPA------KVTPLAAHQQPHQAPVITSTAPHH--HHHHTDSSHHDFESS 369
                 |...||.....||      ...||....||| :|.:   ||..  ..|:.:...|.    
  Rat   174 -----SFPWPPGAARSPALPYLSSATVPLPTPAQPH-SPFL---APMQGLDRHYLNLIGHG---- 225

  Fly   370 REPILHTDTSNMHSPPPRDLLLQQHP 395
                 |.:|.|:|:|        |||
  Rat   226 -----HPNTLNLHTP--------QHP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 23/51 (45%)
ORANGE 126..168 CDD:128787 6/41 (15%)
HeltXP_008769494.1 bHLH-O_HELT 14..69 CDD:381414 25/60 (42%)
Hairy_orange 87..127 CDD:400076 13/83 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1054305at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.