DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:182 Identity:41/182 - (22%)
Similarity:76/182 - (41%) Gaps:49/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGR--GRIEKTEIIEMAIRHLKHLQS 119
            :||.:...:...::|::||.|:|.||.:|..::.....::|.  .|:||.:|:|:.:.|:|.|::
  Fly     8 SKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRA 72

  Fly   120 ECQQKES------------------DYRSGYMDCMKEAAKFLYDVH----------MQDFCHRL- 155
            :.|.:.|                  .:|:||:....|.:|.|..|.          |....||| 
  Fly    73 QKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLN 137

  Fly   156 ----------LG-RLQEHIDEM-------FKTDCYKSTRSCHMPDNVSASSG 189
                      :| .||..:::.       .:.|..:|......|...|::||
  Fly   138 YLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 16/53 (30%)
ORANGE 126..168 CDD:128787 15/88 (17%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 17/61 (28%)
ORANGE 97..141 CDD:128787 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438364
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.