DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and helt

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_996948.1 Gene:helt / 404275 ZFINID:ZDB-GENE-040824-6 Length:270 Species:Danio rerio


Alignment Length:224 Identity:60/224 - (26%)
Similarity:102/224 - (45%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS--- 119
            |..::.|:||::||||||||:|.||.:|.:.:|....::..|::||.||:||.:::|:.|.|   
Zfish    55 KDRKKTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQNSGKLEKAEILEMTVQYLRALHSADF 119

  Fly   120 -------ECQQKESDY-RSGYMDCMKEAAKFLYDVHMQDF----CHRLLGRLQEHI--DEMF--- 167
                   |...:.::| ..||.:|||....:|..|...:.    ..|:|..||..:  :.:|   
Zfish   120 PRGREKGELLTEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKVVTEPVFGSL 184

  Fly   168 ------KTD--CYKSTRSCHMPDNVSASSGSPHQAYH-----PPLCHLRDMLATSASDVEHSQDH 219
                  .||  |....:|....::|...|...|.::|     |.|.:        .:..:||...
Zfish   185 GTISPDPTDLLCQLEYQSPSPTESVFQQSPPGHFSWHSSTRSPTLAY--------PAMSQHSGYL 241

  Fly   220 NDVKDLSFRNHLN-------QLQRSQQAA 241
            :.|:.|. .:::|       .|..:|.||
Zfish   242 SPVQGLD-HHYMNFIGHNAFSLHNAQHAA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 23/51 (45%)
ORANGE 126..168 CDD:128787 13/57 (23%)
heltNP_996948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
HLH 62..115 CDD:278439 23/52 (44%)
Hairy_orange 136..173 CDD:284859 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1054305at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.