DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and hes4

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_988870.1 Gene:hes4 / 394465 XenbaseID:XB-GENE-487830 Length:281 Species:Xenopus tropicalis


Alignment Length:338 Identity:76/338 - (22%)
Similarity:118/338 - (34%) Gaps:104/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TESSLNFSTSATAYSEDDAEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQR 95
            |.|.:..:.:::|.:.|..:.|:..| |:|:.      |:|||||.|:|..|..|..||....::
 Frog    10 TASPIAGAPASSAQTPDKPKSASEHR-KSSKP------IMEKRRRARINESLGQLKTLILDALKK 67

  Fly    96 KG--RGRIEKTEIIEMAIRHLKHLQSECQQKES---------DYRSGYMDCMKEAAKFLYDVHMQ 149
            ..  ..::||.:|:||.::||::|| ..|...:         .||:|:.:||.|..:||      
 Frog    68 DSSRHSKLEKADILEMTVKHLRNLQ-RVQMTAALTADPSVLGKYRAGFNECMNEVTRFL------ 125

  Fly   150 DFCH--------RLLGRLQEHIDEMFKTDCYKSTRSCHMPDNVSASSGSPHQAYHPPLCHLRDML 206
            ..|.        ||||.|...:.::...: |:...|...|.:|...|.:|  |..|..|      
 Frog   126 STCEGVNTEVRTRLLGHLSSCLGQIVAMN-YQQPPSSQQPLHVQLPSSTP--APVPMPC------ 181

  Fly   207 ATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQQAAAAAAVAAAAVAVANGSSPASNAGVDSKVPL 271
                                                       .|..|...||....|....||.
 Frog   182 -------------------------------------------KVNPAEAISPKVFQGGFQLVPA 203

  Fly   272 TNGGGTGGAPPAADNVPSNSTGSGSAAAC-AGGNSNSSGSNSSNAASSTICPPAGGSCPAKVTPL 335
            |:|......|.     |:.:|..|..... |..|..|.|...|.:             |.:....
 Frog   204 TDGQFAFLIPN-----PAYTTSPGPVIPLYANTNVTSPGGPQSQS-------------PVQGLTT 250

  Fly   336 AAHQQPHQAPVIT 348
            ..|:.||.|..::
 Frog   251 FGHKMPHMAQAVS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 19/53 (36%)
ORANGE 126..168 CDD:128787 14/58 (24%)
hes4NP_988870.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 9/40 (23%)
bHLH-O_HES1_4 33..95 CDD:381465 24/69 (35%)
Hairy_orange 110..147 CDD:369405 14/42 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281 0/2 (0%)
WRPW motif. /evidence=ECO:0000255 278..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.