DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and HELT

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001287710.1 Gene:HELT / 391723 HGNCID:33783 Length:242 Species:Homo sapiens


Alignment Length:349 Identity:80/349 - (22%)
Similarity:123/349 - (35%) Gaps:126/349 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGRGRIEKTEIIEMAIRHLKHLQS--- 119
            |..::.|:||::||||||||:|.||.:|.:.:|....::..|::||.||:||.:::|:.|.|   
Human     6 KERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADF 70

  Fly   120 -------ECQQKESDY-RSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKSTR 176
                   |...:.::| ..||.:|||....:|..|                  |..:|   |.|:
Human    71 PRGREKAELLAEFANYFHYGYHECMKNLVHYLTTV------------------ERMET---KDTK 114

  Fly   177 SCHMPDNVSASSGSPHQAYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQRSQQAA 241
            ...:...:.:.:....:...|||..|.:                  .|.|::.|          .
Human   115 YARILAFLQSKARLGAEPAFPPLGSLPE------------------PDFSYQLH----------P 151

  Fly   242 AAAAVAAAAVAVANGSSPASNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTGSGSAAACAGGNSN 306
            |....|        |.||    |..:..|..:|.|....||                        
Human   152 AGPEFA--------GHSP----GEAAVFPQGSGAGPFPWPP------------------------ 180

  Fly   307 SSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQQPHQAPVITSTAPHHHHHHTDSSHHDFESSRE 371
                   .||.|    ||....|:...|||:..|.| :|.:|.......|:.....|        
Human   181 -------GAARS----PALPYLPSAPVPLASPAQQH-SPFLTPVQGLDRHYLNLIGH-------- 225

  Fly   372 PILHTDTSNMHSPPPRDLLLQQHP 395
              .|.:..|:|:|        |||
Human   226 --AHPNALNLHTP--------QHP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 23/51 (45%)
ORANGE 126..168 CDD:128787 9/42 (21%)
HELTNP_001287710.1 bHLH-O_HELT 14..69 CDD:381414 25/54 (46%)
Hairy_orange 87..127 CDD:400076 11/60 (18%)
PRK14951 <133..>207 CDD:237865 29/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1054305at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.