DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and h

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:335 Identity:82/335 - (24%)
Similarity:133/335 - (39%) Gaps:99/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RQDPLSHR-IIEKRRRDRMNSCLADLSRLI-------PPQYQRKGRGRIEKTEIIEMAIRHLKHL 117
            :.|..|:: |:|||||.|:|:||.:|..||       |.::     .::||.:|:|..::||:.|
  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARH-----SKLEKADILEKTVKHLQEL 88

  Fly   118 QSE--CQQKESD------YRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDCYKS 174
            |.:  ..|:.:|      :::|:.||:.|.::|......|.  .|||..|...|:.: ||:.::.
  Fly    89 QRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQR--RRLLQHLSNCINGV-KTELHQQ 150

  Fly   175 TR-----SCH---MPDNVSASSGSPHQAYHPP-------------LCHLRDMLATS------ASD 212
            .|     |.|   :|...|:......|....|             |.:...::.|.      |..
  Fly   151 QRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALV 215

  Fly   213 VEHSQDHNDVKDLSFRNHLNQLQRSQQAAAAAAVAAAAVAVANGSSPASNAGVDSKVPLTNGGGT 277
            :..|......:.|     |...|:.||.|.|||.||||.|...                      
  Fly   216 LPQSLPQQQQQQL-----LQHQQQQQQLAVAAAAAAAAAAQQQ---------------------- 253

  Fly   278 GGAPPAADNVPSNSTGSGSAAACAGGNSNSSGSNSSNAASSTIC---PPAGGSC--------PAK 331
                |...::|..:..:|||      :|:||....|...||:.|   ||:..:.        |:.
  Fly   254 ----PMLVSMPQRTASTGSA------SSHSSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSV 308

  Fly   332 VTPLAAHQQP 341
            :..:...|||
  Fly   309 IQRVPMEQQP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 21/59 (36%)
ORANGE 126..168 CDD:128787 12/47 (26%)
hNP_001014577.1 HLH 29..88 CDD:238036 22/63 (35%)
ORANGE 106..141 CDD:128787 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438372
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.