DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and HES5

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_005244808.1 Gene:HES5 / 388585 HGNCID:19764 Length:198 Species:Homo sapiens


Alignment Length:172 Identity:42/172 - (24%)
Similarity:65/172 - (37%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIEKRRRDRMNSCLADLSRLIPPQYQR-KGRGRIEKTEIIEMAIRHLKHLQSE------------ 120
            ::||.||||:||.:..|..|:..::.| :...::||.:|:|||:.:|||.:.|            
Human    23 VVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGERARAPRAPSSHR 87

  Fly   121 -------------------------CQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQ 160
                                     .:....||..||..|::||.:||......|...:||...|
Human    88 APAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ 152

  Fly   161 EHIDEMFKTDCYKSTRSCHMPDNVSASSGSPHQAYHPPLCHL 202
            ....................|..:||.:.:...|.|.|.|.|
Human   153 RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 20/49 (41%)
ORANGE 126..168 CDD:128787 13/41 (32%)
HES5XP_005244808.1 HLH 14..71 CDD:238036 18/47 (38%)
Hairy_orange 118..153 CDD:295407 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.