DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cwo and her15.2

DIOPT Version :9

Sequence 1:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001099062.1 Gene:her15.2 / 359836 ZFINID:ZDB-GENE-070627-1 Length:149 Species:Danio rerio


Alignment Length:169 Identity:40/169 - (23%)
Similarity:74/169 - (43%) Gaps:35/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ATAYSEDDAEYATGRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKG-RGRIEKT 104
            |..|..:.::.:...::|      |...::||.||||:|:|:..|..::..::|::. ..::||.
Zfish     2 APVYMTEYSKLSNKEKHK------LRKPVVEKMRRDRINNCIEQLKSMLEKEFQQQDPNAKLEKA 60

  Fly   105 EIIEMAIRHLKHLQSECQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKT 169
            :|:||.:..||. |...:..::....||..|.:|...|| .|..:....||              
Zfish    61 DILEMTVVFLKQ-QLRPKTPQNAQIEGYSQCWRETISFL-SVGSEAVAQRL-------------- 109

  Fly   170 DCYKSTRSCHMPDNVSASSGSPHQAY---------HPPL 199
              .:..|....|: ::.:|.:|||.:         |.||
Zfish   110 --QQEARRSAAPE-LTHTSEAPHQQHTHIKQEPRAHAPL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cwoNP_524775.1 HLH 66..118 CDD:306515 17/52 (33%)
ORANGE 126..168 CDD:128787 9/41 (22%)
her15.2NP_001099062.1 HLH 19..72 CDD:278439 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.